<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16687
Description |
Uncharacterized protein |
Sequence | MTCYTGSLVLLIYSFVLEAITYMQEVLLFTTYLDTSRSMLVQRYNFFLGSGLKHLFIFFCKCGRLLAMDKRLALLLPPVSRPYRHFFPTVTSSAQLISSTNEQSSDVVNAYHIGCFSEDAQ |
Length | 121 |
Position | Tail |
Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.14 |
Grand average of hydropathy | 0.350 |
Instability index | 41.06 |
Isoelectric point | 7.68 |
Molecular weight | 13799.93 |
Publications | PubMed=29259619
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16687
No repeats found
No repeats found
|