<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16687
| Description |
Uncharacterized protein |
| Sequence | MTCYTGSLVLLIYSFVLEAITYMQEVLLFTTYLDTSRSMLVQRYNFFLGSGLKHLFIFFCKCGRLLAMDKRLALLLPPVSRPYRHFFPTVTSSAQLISSTNEQSSDVVNAYHIGCFSEDAQ |
| Length | 121 |
| Position | Tail |
| Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | 0.350 |
| Instability index | 41.06 |
| Isoelectric point | 7.68 |
| Molecular weight | 13799.93 |
| Publications | PubMed=29259619
|
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16687
No repeats found
No repeats found
|