<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16683
| Description |
Uncharacterized protein |
| Sequence | MDPEGKNFGRGPRELTGAVDLISHYKLLPHHDFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTSRDTSARIQPFDLDVLREAFQLRETSPVDLPPAEKGVPTLAGKSKSESKDKERKHKKHKDKDKEKDREHKKHKHRHKDRSKDKDKDKDKKKDKSGHHDSSADPSKKHHEKKRKHDGDEDLNDIHRQKKSKHKSSKIDEVGAIKVAG |
| Length | 219 |
| Position | Head |
| Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.521 |
| Instability index | 36.85 |
| Isoelectric point | 9.52 |
| Molecular weight | 25191.97 |
| Publications | PubMed=29259619
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16683
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.71| 19| 19| 122| 140| 1
---------------------------------------------------------------------------
122- 140 (34.31/10.72) KDKERKHKK..HKDKDKEKDR
158- 178 (26.40/ 6.76) KDKDKKKDKsgHHDSSADPSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 67.39| 18| 18| 69| 86| 3
---------------------------------------------------------------------------
49- 66 (17.79/10.78) .LHNVV.GDTEIRKgEGMQL
69- 86 (31.00/23.64) LIQNTS.RDTSARI.QPFDL
89- 103 (18.61/11.58) LREAFQlRETS.....PVDL
---------------------------------------------------------------------------
|