<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16677
| Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X2 |
| Sequence | MDSESKKFGRGPRELTGAVDLINHYKLWAHHDFFCKRSLPLSISDTHYLHNVVGDTEIRKGDGMELDQLFQNAPYLRETTAHIRPFDLDILGQAFQLRETAPIDLPSAEKGVPTIYSKSKSESKDKERKHKKHKDKDKEKDKEHKKHKHRHKDRTKDKEKKKDKSGHHDSGGDHSKKHHEKKRKHDGNEDLSDAHKHKKK |
| Length | 200 |
| Position | Head |
| Organism | Phoenix dactylifera (Date palm) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.558 |
| Instability index | 42.38 |
| Isoelectric point | 9.52 |
| Molecular weight | 23350.94 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16677
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.18| 15| 15| 132| 146| 1
---------------------------------------------------------------------------
132- 146 (28.57/11.15) KHKDKDKEKDKEHKK
148- 162 (27.61/10.52) KHRHKDRTKDKEKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.53| 16| 19| 164| 182| 2
---------------------------------------------------------------------------
164- 182 (26.15/15.22) KsghHDSGGDHSKKHHEKK
184- 199 (30.39/11.05) K...HDGNEDLSDAHKHKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.53| 14| 19| 69| 87| 3
---------------------------------------------------------------------------
69- 87 (17.98/23.23) LFQnAPYLRETTahirPFD
91- 104 (25.55/14.16) LGQ.AFQLRETA....PID
---------------------------------------------------------------------------
|