<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16676
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATSSSYPPPPPYYRLYKDYLEDPKSAPEPPPPIHDATYPLFGATYTTDVVLPSLEDQGVRQLYPNGPNIDFKKVLQSLNRDLQLHILELADVLVERPSQYARRVEDISLIFKNLHHVLNSLRPHQARATLIHILECQIQRRKQAIEDIKRRREEAQRLLKESLQTLDGHQP |
| Length | 172 |
| Position | Middle |
| Organism | Phoenix dactylifera (Date palm) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.647 |
| Instability index | 79.20 |
| Isoelectric point | 7.07 |
| Molecular weight | 19921.47 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16676
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.19| 23| 23| 81| 103| 2
---------------------------------------------------------------------------
78- 100 (38.30/24.26) SLNR..DLQLHILELADVLVE.RPSQ
101- 126 (30.21/17.86) YARRveDISLIFKNLHHVLNSlRPHQ
128- 144 (22.67/11.90) ...R..ATLIHILE...CQIQ.RRKQ
---------------------------------------------------------------------------
|