<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16666

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMQSHTPPVMPSPARLGLTNAHSPSLPPNPGHNPNPNPNPKPAPSSSVSSSATAPTAGHHHPVTAATTTSSALLSLLPPLPRGQALLAQMASLATKLFDVSPHRAHWLASFRGSLPSFLPSASASATPLSSSCSSSTSAAPSSAKEVVALFTALQTQIFESVAELQEILDLQDSCLKIAGEIRAKDSTLLSFTKKIREAEQVLDQLVDDYSDYRRDPKRPKSDKDSFDSGYSTSLRSSLDLQEILSYAHRISYTTFAPPEHGAGLAPLRGALPPAPQENEMRASQLYHFADLDVGVPKKAPEAKERVADALAEVPLMEPTPPREEVPVPIPPPMLPITVPPGWRKGMPVELPSELPPPPPGWKPGDPITLPLDGVVVGNREEQRVGGVPGIPGMPAPPPKAPEAIQVKYVQLDINPDQDDYSSDYSSDVGSSDEDDED
Length437
PositionMiddle
OrganismPhoenix dactylifera (Date palm)
KingdomViridiplantae
Lineage
Aromaticity0.05
Grand average of hydropathy-0.422
Instability index63.63
Isoelectric point5.08
Molecular weight46515.75
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP16666
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.14|      12|      16|     334|     348|       1
---------------------------------------------------------------------------
  314-  325 (23.49/ 7.72)	PL......MEPT.PP..REEV
  326-  346 (10.65/10.05)	PVpipppmLPITvPPgwRKGM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     105.17|      25|      25|      22|      46|       3
---------------------------------------------------------------------------
   25-   51 (43.68/15.66)	LPPNPGHNP....NPNPNPKPAPSSSvsSSA
   52-   75 (29.10/ 7.98)	TAPTAGHH.......HPVTAATTTSSalLSL
  107-  135 (32.39/ 9.72)	LASFRGSLPsflpSASASATPLSSSC..SSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     113.76|      29|      77|     140|     168|       4
---------------------------------------------------------------------------
  140-  168 (45.42/20.31)	PSSAKEVVAL.FTALQTQIFESVAELQEIL
  180-  204 (26.49/ 9.99)	EIRAKDSTLLsFT...KKIREAEQVLDQ..
  219-  244 (41.85/18.36)	PKSDKDS....FDSGYSTSLRSSLDLQEIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.15|      13|     118|     273|     298|       5
---------------------------------------------------------------------------
  256-  268 (25.52/ 7.99)	APPE.........HGAGLA...PLR
  274-  298 (12.62/27.30)	APQEnemrasqlyHFADLDvgvPKK
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP16666 with Med4 domain of Kingdom Viridiplantae

Unable to open file!