<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16661

Description pre-mRNA-processing protein 40A-like isoform X2
SequenceMSMQFRPVVPAQQTHQFIPAASQQFRPVGQGVPGSNIGISSGQTQMHHFPQPAQHLPRSGPPAPPSSQAIPMPYGQPSRPMTSGSLQPQQNPQMQNSHLPNLGGIGMPLSSSYTFATSYCQPPNTLNNPSQYQPASQMQAPITPAMGQPWSAPGTQNVPLVTPLVQAAPQSSATGAAVGTAATTNAQPRSSEQVSSDWQEHTSVDGKRYYYNKKTRQSSWEKPLELMTPIERADASTDWKEFSTSDGRTYYYNKVTKISKWIIPDELKLAREQALRAAAQQAHTETGTASVAPVAPTVSSGEIPSATTDSVTPGTTSAVVSSSVPVAVNSITPPAVMASVSPSVVPSAGISSSSSLGIPNTIGSSNLQTTVTPLPAPVSANTVVSTVAIESASSNTKSNHDSSSLLNTASVPDGASAQDLEEAKKAMPVTGRVNVTPLEEKTIDEEPLVYSNKQEAKAAFKALLESANVESDWTWEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEECKELTSSTRWSKAVTMFENDERFHAVERARDREDLFESYLVDLQKKERAKAAEEHKRNIMEYRTFLESCDFIKANTQWRKVQDRLEDDERCSRLEKIDRLEIFQEYIHDLEKEEEEQRKIQKEQLRRLERKNRDEFRKLMEEHVAAGILTAKTHWRDYCMQVKDLPPYIAVSSNTSGSTPKDLFEDVAEELDKQYHEDKAQIKEAIKIRKIALASSWTFEDFKAATSGDDSLQGISETNMKLVFDELLERLREKEEKEAKKRQRLADNFSDLLYSIKEITASARWEDCKSLFEDTQEYRSIGDENFVKEIFEEHVAHLQEKLKEKERKREEEKAKKEKEREEKEKRKEKERKEKEERKEKEREREKEKGKDRSRKDEAESENVDMMDSHGSKDKKRENDKERKHRKRHHSMVDDVSSEKDDKEESKKSRRRRHSGDRKKSRKHTYTTDSDSENRHKRHKKDRDGSRRNGGYEELEDGELGEDGEIHAV
Length1021
PositionUnknown
OrganismPhoenix dactylifera (Date palm)
KingdomViridiplantae
Lineage
Aromaticity0.06
Grand average of hydropathy-1.044
Instability index53.95
Isoelectric point6.55
Molecular weight115832.57
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16661
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     112.32|      21|      21|     853|     873|       1
---------------------------------------------------------------------------
  778-  797 (24.74/ 8.34)	DELLERLREKEEKEAKK.RQR
  877-  897 (31.34/12.36)	EKRKEKERKEKEERKEKERER
  898-  918 (25.44/ 8.77)	EKEKGKDRSRKDEAESENVDM
  920-  940 (30.79/12.03)	DSHGSKDKKRENDKERKHRKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     168.08|      39|      39|     195|     233|       2
---------------------------------------------------------------------------
  123-  154 (37.42/17.85)	...PNTLNNPSQYQPASQMQAPITPA..........................mGQPW....SAPG.
  155-  207 (22.95/ 8.15)	.......TQN......VPLVTPLVQAapqssatgaavgtaattnaqprsseqvSSDWQEHTSVDGK
  208-  248 (64.25/35.83)	RYYYNKKTRQSSWEKPLELMTPIERA.........................daSTDWKEFSTSDGR
  249-  284 (43.47/21.91)	TYYYNKVTKISKWIIPDELKLAREQA.........................lrAAAQQAHT.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     105.51|      17|      17|     310|     326|       3
---------------------------------------------------------------------------
  290-  304 (16.97/ 7.58)	....SVAP.....VAPTVSSGE......IP
  310-  325 (23.41/13.62)	....SVTP....GTTSAVVSSS......VP
  326-  346 (16.64/ 7.27)	VavnSITP....PAVMASVSPS.....vVP
  356-  368 (15.92/ 6.59)	L...GIP........NTIGSSN......LQ
  369-  389 (15.50/ 6.20)	T...TVTPlpapVSANTVVSTV......AI
  390-  412 (17.08/ 7.69)	E...SASS....NTKSNHDSSSllntasVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      56.09|      17|      17|     637|     653|       4
---------------------------------------------------------------------------
  564-  580 (20.00/ 9.35)	DREDLF.ESYLVDLQK....KE
  609-  629 (17.44/ 7.24)	TQWRKV.QDRLEDDERcsrlEK
  630-  647 (18.65/ 8.24)	IDRLEIfQEYIHDLEK....EE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     151.52|      32|      34|      19|      52|       6
---------------------------------------------------------------------------
   19-   52 (57.14/32.83)	PAA..SQQFRPV..GQGVPGSniGISSGQTQMHHFPQP
   61-   88 (44.79/20.55)	PPAppSSQAIPM..PYGQPSR..PMTSGSLQ......P
   92-  122 (49.58/23.39)	PQM..QNSHLPNlgGIGMP.....LSSSYTFATSYCQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.22|      20|      22|     956|     975|       7
---------------------------------------------------------------------------
  956-  975 (34.76/21.44)	EESKKSRRRRHSGDRKKSRK
  981- 1000 (35.45/22.04)	DSDSENRHKRHKKDRDGSRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     175.20|      35|     274|     525|     559|       8
---------------------------------------------------------------------------
  460-  491 (44.01/28.30)	..FKALL.ESANVESDWTWEQAMRVIINDKRYGAL
  499-  520 (20.51/ 8.54)	QAFNEYLGQRKKQEAEERRIKQ.............
  525-  559 (57.66/39.78)	EDFTRMLEECKELTSSTRWSKAVTMFENDERFHAV
  800-  834 (53.01/35.87)	DNFSDLLYSIKEITASARWEDCKSLFEDTQEYRSI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16661 with Med35 domain of Kingdom Viridiplantae
Unable to open file!