<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16656
| Description |
mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MSLLKRKLGEVNATSIDLPPVTDEEEIMLAPEALLDTRWVKKGSKFVEESLSYPRDKLTALPALLGIRVSGERIRDLRWNQGLGIDRGGKRARVSEIGALSRLMAAKSRQELGIEGQRHLEETINAAFQILSSMNDELCNPALWSTSPAAAHPPASGDGSSDSSSHHSEVSTGGGGGGGGGALDEARLRYKSAIANLRAVIAAIPSSPQETGALEAKADPAEIQRLEERVSDLRKELENKNKYLKHLIDQLRSLITDISMWQSPCSA |
| Length | 267 |
| Position | Head |
| Organism | Phoenix dactylifera (Date palm) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.416 |
| Instability index | 60.54 |
| Isoelectric point | 6.03 |
| Molecular weight | 28855.29 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16656
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.36| 16| 37| 27| 43| 1
---------------------------------------------------------------------------
27- 43 (24.71/20.16) IMLAPEALLDTRWvKKG
67- 82 (29.65/19.31) IRVSGERIRDLRW.NQG
---------------------------------------------------------------------------
|