<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16641
Description |
mediator of RNA polymerase II transcription subunit 21-like |
Sequence | MSAALVEAAKKFDALVSALPLSGEEAQLKKIAELQAENEAVGLELEKQLKAAEQELKQVQELFHQAADNCLNLKKPY |
Length | 77 |
Position | Middle |
Organism | Phoenix dactylifera (Date palm) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.268 |
Instability index | 33.26 |
Isoelectric point | 4.92 |
Molecular weight | 8435.59 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16641
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.60| 25| 27| 21| 47| 1
---------------------------------------------------------------------------
21- 47 (34.81/21.07) LSGEEAQLKKIAEL..QAENEAvgLELEK
49- 75 (36.78/17.06) LKAAEQELKQVQELfhQAADNC..LNLKK
---------------------------------------------------------------------------
|