<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16641
| Description |
mediator of RNA polymerase II transcription subunit 21-like |
| Sequence | MSAALVEAAKKFDALVSALPLSGEEAQLKKIAELQAENEAVGLELEKQLKAAEQELKQVQELFHQAADNCLNLKKPY |
| Length | 77 |
| Position | Middle |
| Organism | Phoenix dactylifera (Date palm) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.268 |
| Instability index | 33.26 |
| Isoelectric point | 4.92 |
| Molecular weight | 8435.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16641
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.60| 25| 27| 21| 47| 1
---------------------------------------------------------------------------
21- 47 (34.81/21.07) LSGEEAQLKKIAEL..QAENEAvgLELEK
49- 75 (36.78/17.06) LKAAEQELKQVQELfhQAADNC..LNLKK
---------------------------------------------------------------------------
|