<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16632
| Description |
mediator of RNA polymerase II transcription subunit 15a isoform X2 |
| Sequence | MEANSWRLAQGEASAADAASGDWRTLLPHELRQWIVDDLIMGTLKRSFPIAVPGALNELQKIAERFEEKIYTAATSETDYLRIISLKMLTMERKPQHTPPINPSMPNPAVPNQNPTEPARQQLLPQNFQNNTPAAGQSSANLPSALSSITGLGQSNISQNMPGISQPQDQQQFQVSQLQQPGNHPNQVQ |
| Length | 189 |
| Position | Tail |
| Organism | Phoenix dactylifera (Date palm) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.633 |
| Instability index | 55.94 |
| Isoelectric point | 5.57 |
| Molecular weight | 20813.10 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16632
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.68| 14| 15| 112| 125| 1
---------------------------------------------------------------------------
112- 125 (25.48/10.95) NQNPTEPARQQLLP
130- 143 (24.20/10.10) NNTPAAGQSSANLP
---------------------------------------------------------------------------
|