<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16632
Description |
mediator of RNA polymerase II transcription subunit 15a isoform X2 |
Sequence | MEANSWRLAQGEASAADAASGDWRTLLPHELRQWIVDDLIMGTLKRSFPIAVPGALNELQKIAERFEEKIYTAATSETDYLRIISLKMLTMERKPQHTPPINPSMPNPAVPNQNPTEPARQQLLPQNFQNNTPAAGQSSANLPSALSSITGLGQSNISQNMPGISQPQDQQQFQVSQLQQPGNHPNQVQ |
Length | 189 |
Position | Tail |
Organism | Phoenix dactylifera (Date palm) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.633 |
Instability index | 55.94 |
Isoelectric point | 5.57 |
Molecular weight | 20813.10 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16632
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.68| 14| 15| 112| 125| 1
---------------------------------------------------------------------------
112- 125 (25.48/10.95) NQNPTEPARQQLLP
130- 143 (24.20/10.10) NNTPAAGQSSANLP
---------------------------------------------------------------------------
|