<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16623
Description |
mediator of RNA polymerase II transcription subunit 32-like |
Sequence | MESTVEALSAAYQEFVAAAAGVLDAKEQSGGKKTAATDAALELFKQRWELFRVSCDQAEEFVESMKQRIGSECLVDEATGAAPARPPAASGIPPISAVRLEQMSKAVRWLVIELQHGAGAAAGAAPHPHTSAPFDARFSEDGAP |
Length | 144 |
Position | Tail |
Organism | Phoenix dactylifera (Date palm) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.148 |
Instability index | 61.04 |
Isoelectric point | 4.93 |
Molecular weight | 15108.79 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16623
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.01| 16| 40| 78| 97| 2
---------------------------------------------------------------------------
78- 97 (21.52/19.42) ATGAAParPPAASGipPISA
121- 136 (32.50/15.31) AAGAAP..HPHTSA..PFDA
---------------------------------------------------------------------------
|