<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16621

Description U-box domain-containing protein 33
SequenceMKVLSPSPPPSPTVDRFGGAPPPPPPPAFRRALGRGSTARGERDGRLHVAVGRSPEKTLALLRWAFRRFGCREIGLLHVHQPSPVIPTLLGKIPASQANEELVSTYRRTEKEITKRLLLTYLRFCHKAQVQPSIIMTEAEQIHNGIVDLVVQHGIRRLIMGSTPDNCFKLKGSSSKATYAAKNAPPFCEIWFVSKGGHVWTREASEGTNSFLSVFSPEAAVLREQIRLSYLHKDYCEPMPNPEYVLSNTFTTADLQGDTGMNQTESNSTGVVVSTDSSIVNSTNLSNSQYPSSLPDTPSYPTSPVDIGFSSKINSQDKLEPEVSFDQLKEVNLEVERSKKEAFVELVKRREVESEVEEALNRVKALEAAHAREIKIREELEDLLTTIKLHHKELINQRDETMKELQNALSTTATLDARAREMSLLKDEAAAELDLIQSFVAILRLERQKIQEQEEKAVAQLERRRCSSKATSPNYSQLIGLGSDSYNFTEFSLSDLESATCGFSESFKLGQGGYGCVYKGEIFNRSVVIKKLHPHNVRGQMEFQQEVYVLSKLRHPHLVTLVGVCPEALSLVYEYLPNGTLHDRLFCKTTTPPLTWRVRTCIAAQISSALLFLHSSKPEKIIHGDLKPDNIFLDSNFNCKIGDFGICRLVPEDVEYYPLFRRNREPKGAFSYADPEYQRTDMLTPKSDVYSFGIIILQLLTGRPPQGLATEVRRAVLCGKLSSILDPAAGEWPGDAARRLAEFGLRCSELNSRDRPELTPEVVRELEQLHLMEERPVPPFFLCPILQEIMHDPQVAADGFTYEGRALRGWLESGRETSPMTNLKLKHLNLTPNHALRFAIQDWLCHC
Length847
PositionTail
OrganismPhoenix dactylifera (Date palm)
KingdomViridiplantae
Lineage
Aromaticity0.07
Grand average of hydropathy-0.374
Instability index50.02
Isoelectric point6.67
Molecular weight95127.43
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16621
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.08|      19|      19|     318|     336|       1
---------------------------------------------------------------------------
  318-  336 (31.18/17.57)	KLEPEVSFDQLKEVNLEVE
  339-  357 (29.90/16.59)	KKEAFVELVKRREVESEVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.45|      19|      19|     519|     537|       2
---------------------------------------------------------------------------
  519-  537 (35.53/23.47)	KGEI.FNRSV.VIKKL.HPHNV
  538-  559 (22.93/12.71)	RGQMeFQQEVyVLSKLrHPHLV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.54|      13|      17|     402|     416|       5
---------------------------------------------------------------------------
  402-  416 (16.88/17.17)	MKELQNalSTTATLD
  422-  434 (20.66/13.21)	MSLLKD..EAAAELD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.21|      10|      18|     370|     379|      11
---------------------------------------------------------------------------
  370-  379 (16.78/11.39)	HAREIKIREE
  391-  400 (17.43/12.11)	HKELINQRDE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16621 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MKVLSPSPPPSPTVDRFGGAPPPPPPPAFRRALGRGSTARGERDGRLHVA
1
50










Molecular Recognition Features






MoRF SequenceStartStop




NANANA