<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16612
Description |
mediator of RNA polymerase II transcription subunit 15a-like |
Sequence | MVITASEDADMVAAAAGGEGTVIKCCFNAVFLCPNLKSQFASDQMSPIVPLRILIPTNYPKSSPILLDMLPSELSKEFGDLSVKAWSRFRMSLRDLPQPLLLREIVKTWDACAHKVIDEYAQQTGGGSFSSRFGAWENCVSS |
Length | 142 |
Position | Tail |
Organism | Phoenix dactylifera (Date palm) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.08 |
Grand average of hydropathy | 0.080 |
Instability index | 52.91 |
Isoelectric point | 5.34 |
Molecular weight | 15532.78 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16612
No repeats found
|