<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16609
Description |
mediator of RNA polymerase II transcription subunit 36a-like |
Sequence | MRPPRGGGRGAGPRGRSDGGGGRGRGRGFGGRGGDRGGGRGGGRGGGRGGGRGGGRGGRGRGGGMKGGSKVIVQPHRHDGVFVAKGKEDALCTRNLVAGDSVYGEKRISVQNEEGTKVEYRIWNPFRSKLAAAIIGGVDNIWMGPGSRVLYLGAASGTTVSHVSDLVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPARYRMLVGMVDVIFSDVAQPDQARILALNASYFLKNGGHFVISIKANCIDSTVPAEAVFAQEVKKLQAEQFKPAEQVTLEPFERDHACVVGGYRMPKKQKVATES |
Length | 311 |
Position | Unknown |
Organism | Phoenix dactylifera (Date palm) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.442 |
Instability index | 34.86 |
Isoelectric point | 10.34 |
Molecular weight | 32802.88 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16609
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.14| 18| 19| 30| 47| 1
---------------------------------------------------------------------------
30- 47 (44.04/10.79) GGRGGDRGG.GRGGGRGGG
50- 68 (37.10/ 8.16) GGRGGGRGGrGRGGGMKGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.53| 14| 17| 199| 212| 3
---------------------------------------------------------------------------
199- 212 (25.53/18.06) IIEDARHPARYRML
219- 232 (24.00/16.59) IFSDVAQPDQARIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.81| 12| 22| 122| 133| 5
---------------------------------------------------------------------------
122- 133 (23.44/17.96) IWNPFRSK...LAAA
141- 155 (19.37/13.38) IWMGPGSRvlyLGAA
---------------------------------------------------------------------------
|