<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16604
| Description |
mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAATPLPPAGQVAAMAAGGEGNPPGMPPPPGTDMTGICFRDQLWLNTYPLDRSLVFDYFALSPFYDWSCNNEQLRSRSIHPLDLSHLSKMTGIEYVLSEVMEPHLFVIRKQKRDGPEKVNPMLTYYILDGSIYQAPQLCNIFAARMGRALYHISKAFNTASSKLEKIGYAEAENEDTNSESKAAKEAIDIKELKRVDHILASLQRKLPPAPPPPPFPEGYAPPSSSEAEKGPEDQQTADPQVPPMDPIIDQGPAKRIKFQ |
| Length | 260 |
| Position | Head |
| Organism | Phoenix dactylifera (Date palm) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.487 |
| Instability index | 66.40 |
| Isoelectric point | 5.44 |
| Molecular weight | 28733.42 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16604
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 92.18| 26| 214| 2| 33| 1
---------------------------------------------------------------------------
8- 33 (52.48/29.19) PAGQVAAMAAGGEGNP.......PGMPP.PPGTD
217- 250 (39.71/11.74) PEGYAPPSSSEAEKGPedqqtadPQVPPmDPIID
---------------------------------------------------------------------------
|