<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16601
| Description |
RNA polymerase II holoenzyme cyclin-like subunit |
| Sequence | MSANYWQSTQCRFWSFTKEQLATMRQKLEEDNAELVRMFPLPQQRHLYIYFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVIATAIYLACKIEESPQHIRLIVTEARQMWGDLVAIDTSKLGECEFFMISEMRSQLIVFQPYRTITALRSELSLVDDEVQLARSVINDHFMTDLPLLYPPHIIAMVAILLALVLRPNNSGPGQNTSGAAAAAGLAAAQQALMRAQGQQAQGGMPEPAAVEPKEKRQQDRVSRVQKFAKWLVDSNVEIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK |
| Length | 319 |
| Position | Kinase |
| Organism | Fusarium oxysporum (Fusarium vascular wilt) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium oxysporum species complex.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.262 |
| Instability index | 56.30 |
| Isoelectric point | 8.95 |
| Molecular weight | 36685.95 |
| Publications | PubMed=30202022
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16601
No repeats found
|