<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16580
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSQPEDPRAANKARFELELEFVQSLANPFYLHSLAQQNILNQPAFVNFLKYLLYWKEKDYARFIHYPHALHHLDLLQHAQFRSEIGKDEWREYLNQKQFDHWRTW |
| Length | 105 |
| Position | Middle |
| Organism | Wolfiporia cocos (strain MD-104) (Brown rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Wolfiporia.
|
| Aromaticity | 0.17 |
| Grand average of hydropathy | -0.751 |
| Instability index | 56.29 |
| Isoelectric point | 6.64 |
| Molecular weight | 12916.41 |
| Publications | PubMed=22745431
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16580
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.28| 12| 33| 55| 66| 1
---------------------------------------------------------------------------
55- 66 (24.22/13.10) WKEK.DYARFIHY
90- 102 (22.06/11.43) WREYlNQKQFDHW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.52| 15| 37| 28| 45| 2
---------------------------------------------------------------------------
28- 45 (23.59/19.40) PFYLHSLaqqNILNQPAF
67- 81 (28.93/15.69) PHALHHL...DLLQHAQF
---------------------------------------------------------------------------
|