Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSQPEDPRAANKARFELELEFVQSLANPFYLHSLAQQNILNQPAFVNFLKYLLYWKEKDYARFIHYPHALHHLDLLQHAQFRSEIGKDEWREYLNQKQFDHWRTW |
Length | 105 |
Position | Middle |
Organism | Wolfiporia cocos (strain MD-104) (Brown rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Wolfiporia. |
Aromaticity | 0.17 |
Grand average of hydropathy | -0.751 |
Instability index | 56.29 |
Isoelectric point | 6.64 |
Molecular weight | 12916.41 |
Publications | PubMed=22745431 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16580 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.28| 12| 33| 55| 66| 1 --------------------------------------------------------------------------- 55- 66 (24.22/13.10) WKEK.DYARFIHY 90- 102 (22.06/11.43) WREYlNQKQFDHW --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.52| 15| 37| 28| 45| 2 --------------------------------------------------------------------------- 28- 45 (23.59/19.40) PFYLHSLaqqNILNQPAF 67- 81 (28.93/15.69) PHALHHL...DLLQHAQF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QPEDPRAANKARFEL 2) WREYL | 3 90 | 17 94 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab