Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGITGLARWINAPTTGVEQLRRNIILNHQGVVRGKWQLSLGSYRSTMATVPGVHIPERALFTTTMGDNVFALLEDPAAPTRAEVPQEIREASPGHASAIPAPSHYRNTLVTVSPPGALEQLLSQLRARWVPVRQAGQLGSQASSQKAQLISQQLTIEGLVCAIGTDWLVRFGHVILAGGAVKGMLVEAEYLPLPVLHCDTIDGSSELLSNLLASVLPMVPDVKIVAVTVADSVWDEVLGGPEDEEGVEADTLNGDTDDDIYASPDDLPALRKGDWTGVNRDRRSAFSIVGALKQEGLL |
Length | 298 |
Position | Head |
Organism | Wolfiporia cocos (strain MD-104) (Brown rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Wolfiporia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.010 |
Instability index | 52.80 |
Isoelectric point | 4.92 |
Molecular weight | 31900.89 |
Publications | PubMed=22745431 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16578 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.28| 18| 22| 226| 243| 2 --------------------------------------------------------------------------- 226- 243 (31.44/18.19) AVTVADSVWDEVLGGPED 249- 266 (31.84/18.49) ADTLNGDTDDDIYASPDD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IYASPD 2) LRKGDW | 260 270 | 265 275 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab