<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16568
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MEEEEAELRNPFPSPPSHYTKYTTSNLHLLDLLRERAGDADLSTINQYSLLSDQSDVPEWPLAQLEKPRIDWILEDEHYTVFGDTWPVKEAILSLAELGGHQLYPTDPSVDRRPVLRNILKSVLVTYSRLLDSLLAPPPPVTSSAPPEWHRHVEWITILAQNIMASANDLRPVQARGNLELMMKRQLELRREETRAIHAKCDALEAKLAEMRAAVQKLPQNSAASSVKMDTGRSALQSNQTDNISMEDVLRWAEEIG |
| Length | 257 |
| Position | Middle |
| Organism | Wolfiporia cocos (strain MD-104) (Brown rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Wolfiporia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.485 |
| Instability index | 66.63 |
| Isoelectric point | 5.08 |
| Molecular weight | 29119.62 |
| Publications | PubMed=22745431
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16568
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.26| 35| 82| 49| 89| 1
---------------------------------------------------------------------------
49- 89 (56.69/44.46) SLLSDQSDV.....PEWplaqlEKpRIDW..ILEDEHYTVFGDTWPVK
133- 174 (56.57/30.18) SLLAPPPPVtssapPEW.....HR.HVEWitILAQNIMASANDLRPVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.60| 10| 19| 207| 216| 2
---------------------------------------------------------------------------
207- 216 (16.20/ 9.47) KLAEMRAAVQ
228- 237 (17.39/10.58) KMDTGRSALQ
---------------------------------------------------------------------------
|