Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MTHTGVFFIPSSPNAPNILGPLTERLRSVYGDEAIPIGRWGLEHKLMRDTPSCLPASAHAPNPAPRARYVQFLSMTNHPKLGFVYASEDDEQTQPSPPTAATEAGMGKTESGMIMSAVPIASSSEIFRHFVRCCEPIWCHRHTVTVTGTVYDVGDFRVRLGEVRQTQPQARPRGTIMEIEWRGPSMIAAALAPVSSSLGHDGQNRDVLAMDVDGDIDAAAETPYIPTEAEIQLEYEQMSSLIREFWTKIYNQNDSTNKQLPATTREAILIPDVGRETKQRISQRRQPGWQERENRRRRKRREVIALDRSWGGFSEKQQQQQQDDEDEDVDAGVDLARQYMELFRFNR |
Length | 347 |
Position | Head |
Organism | Penicillium sp. 'occitanis' |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.662 |
Instability index | 60.70 |
Isoelectric point | 5.71 |
Molecular weight | 39251.59 |
Publications | PubMed=28951729 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16556 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 110.59| 32| 71| 92| 123| 1 --------------------------------------------------------------------------- 92- 123 (56.64/29.66) QTQPSPPTAATEAGMGKTESGMIMSAV.PIASS 165- 197 (53.95/27.96) QTQPQARPRGTIMEIEWRGPSMIAAALaPVSSS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 79.60| 22| 230| 33| 68| 2 --------------------------------------------------------------------------- 47- 68 (40.12/15.79) MRDTPSCLPASAHAPNPAPRAR 279- 300 (39.47/19.43) QRISQRRQPGWQERENRRRRKR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SWGGFSEKQQ 2) YMELFRF | 309 339 | 318 345 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab