| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MTHTGVFFIPSSPNAPNILGPLTERLRSVYGDEAIPIGRWGLEHKLMRDTPSCLPASAHAPNPAPRARYVQFLSMTNHPKLGFVYASEDDEQTQPSPPTAATEAGMGKTESGMIMSAVPIASSSEIFRHFVRCCEPIWCHRHTVTVTGTVYDVGDFRVRLGEVRQTQPQARPRGTIMEIEWRGPSMIAAALAPVSSSLGHDGQNRDVLAMDVDGDIDAAAETPYIPTEAEIQLEYEQMSSLIREFWTKIYNQNDSTNKQLPATTREAILIPDVGRETKQRISQRRQPGWQERENRRRRKRREVIALDRSWGGFSEKQQQQQQDDEDEDVDAGVDLARQYMELFRFNR |
| Length | 347 |
| Position | Head |
| Organism | Penicillium sp. 'occitanis' |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.662 |
| Instability index | 60.70 |
| Isoelectric point | 5.71 |
| Molecular weight | 39251.59 |
| Publications | PubMed=28951729 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP16556
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.59| 32| 71| 92| 123| 1
---------------------------------------------------------------------------
92- 123 (56.64/29.66) QTQPSPPTAATEAGMGKTESGMIMSAV.PIASS
165- 197 (53.95/27.96) QTQPQARPRGTIMEIEWRGPSMIAAALaPVSSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.60| 22| 230| 33| 68| 2
---------------------------------------------------------------------------
47- 68 (40.12/15.79) MRDTPSCLPASAHAPNPAPRAR
279- 300 (39.47/19.43) QRISQRRQPGWQERENRRRRKR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) SWGGFSEKQQ 2) YMELFRF | 309 339 | 318 345 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab