| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MEQAQDVHLEEVFWRSPQHVQMMGGFLHSNNILFYFAESPFFDATSNNASLAIQANYNEAFRHFLETREVFEGRLKTMQGLEFMVAYDPLQAAAQSDTQFAHEPSNIWIIRKQTRQKRPGMEDDVVVLSTYYIVGDSVYMAPAVSSVIGNRILSAVTSLTKLMNVASPLPIFTPSYGHTYMPPGPKAADAPQAAAAQQTQQSKESTPMPESQATVKASLSTGNVKDTSYQDTRNLMEALSLLSRYGDEYMDETPLTGEPGSFILSKATETAGTSRRPSGPKAMHAPAVPRRLGTPAVTDMSTPSKGGE |
| Length | 308 |
| Position | Head |
| Organism | Penicillium sp. 'occitanis' |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.393 |
| Instability index | 59.81 |
| Isoelectric point | 5.55 |
| Molecular weight | 33781.62 |
| Publications | PubMed=28951729 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP16550
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 138.82| 34| 94| 173| 207| 1
---------------------------------------------------------------------------
173- 207 (56.35/33.46) TpSYGHTYMPPGPKAADAPQAAAAQQTQQ.SKESTP
243- 270 (37.68/17.23) S.RYGDEYMDETPLTGEPGSFILSKATET.......
272- 303 (44.79/21.47) ....GTSRRPSGPKAMHAPAVPRRLGTPAvTDMSTP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IWIIRK 2) PKAMHAPAVPRRLGTPAVTDMST | 107 280 | 112 302 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab