Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDKYIDGRFERVEKALANLIDSVTKYHPSIQQGEELNAADQELSRGLKEVQTHQNNYLRIQQLRESSNALDTQIRNTLSNLATTRKDIVTTQTTTFPSGPSYPIAYEELLNYARRISKTTMPPAGTIKAVPPTPDVPEVQTPGGQTPAAQTPGPESQAASVMTPSAPPSSQVQSPAVMNGTPVVSQEPATQQSSMSANTVLPSEWTQFLNPLTDQIFLPWPNDLQLGAGSLAANQLLQEQGIDPKGYDPAEEEERKRREEEERKQKEEEDRIAQEEREKKQREERERQRIERERQREKEQEAWRRASLVGGPAAPGEQRSPTGPPQQKAQFQFTNLDDLDDDDDDD |
Length | 346 |
Position | Middle |
Organism | Fusarium oxysporum f. sp. radicis-cucumerinum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium> Fusarium oxysporum species complex. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.074 |
Instability index | 65.20 |
Isoelectric point | 4.75 |
Molecular weight | 38812.17 |
Publications | PubMed=27387256 PubMed=28831051 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16547 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.18| 14| 15| 258| 271| 1 --------------------------------------------------------------------------- 258- 271 (24.42/11.33) REEEERKQKEEEDR 274- 287 (24.77/11.58) QEEREKKQREERER --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.82| 16| 16| 149| 164| 2 --------------------------------------------------------------------------- 146- 162 (24.33/ 8.85) TPaAQTPGPESQAASVM 163- 178 (27.48/10.82) TP.SAPPSSQVQSPAVM --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.12| 23| 28| 76| 103| 3 --------------------------------------------------------------------------- 76- 103 (32.98/29.03) NTLSNLAttRKdivTTQTTTFPSG.....PSYP 107- 134 (38.14/19.86) EELLNYA..RR...ISKTTMPPAGtikavPPTP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.79| 14| 28| 30| 43| 4 --------------------------------------------------------------------------- 30- 43 (24.06/12.12) IQQ.GEELNAADQEL 60- 74 (19.73/ 8.90) IQQlRESSNALDTQI --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) NALDTQIRNTLSNLATTRKDIVTTQTTTFPSGPS 2) NPLTDQIFLPWPNDLQLGAGSLAANQLLQEQGIDPKGYDPAEEEERKRREEEERKQKEEEDRIAQEEREKKQREERERQRIERERQREKEQEAWRRASLVGGPAAPGEQRSPTGPPQQKAQFQFTNLDDLDDDDDDD 3) TMPPAGTIKAVPPTPDVPEVQTPGGQTPAAQTPGPESQAASVMTPSAPPSSQVQSPAVMNGTPVVSQEPATQQSSMSANTVLPSEWTQF | 68 210 120 | 101 346 208 |
MoRF Sequence | Start | Stop |
1) IAYEELLN 2) QEAWRRASLVGGPA 3) QQKAQFQFTNLDDLDDD | 104 300 326 | 111 313 342 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab