<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16546
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDSSPLAGNVSPSSFSVSNLKANCSPGISDNLYPHTPTSPPLMSVGAQNYASNFAHTNTSPSHTTTSNGQLLSSPPSSTPMSTQNSQQPTVSVTASFPTPASSVSGHPRNTTPADESELADKSWGQGPQNSHATSNTDFGNADKSGHRRTDHDRHRLPVGFDMEGRPSATDVDMMDIDSKADNSTPRDSSLDALQQDIGTAFHLCKTVPTITGPDPSFDLISLYGLGPIGRSVMRADPTTGEKINRLRKSYEGKLKGLGLSGRNKAVKNENQAGGLRHLMMWPEEEWQIQKVHGKEIKVAEAESALQKLQMRAMKLEAGPLPNSEYWEDILGHEKPSKHTAFESGKRAVSTPNALRPTVQANGVPATAAAPERARPTRGKKRHYDDNSFVGYGEGFVDDEDEGALYSNSEDRSGKKKRKKVFNLVVYLFRQRS |
Length | 434 |
Position | Head |
Organism | Penicillium sp. 'occitanis' |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.805 |
Instability index | 43.22 |
Isoelectric point | 7.81 |
Molecular weight | 47027.49 |
Publications | PubMed=28951729
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16546
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 100.61| 18| 19| 107| 124| 1
---------------------------------------------------------------------------
107- 124 (31.66/15.31) GH.PRNTTPADESEL..ADKS
126- 146 (19.77/ 7.22) GQgPQNSHATSNTDFgnADKS
147- 162 (27.60/12.55) GH.RR..TDHDRHRL..PVGF
166- 181 (21.58/ 8.44) GR.P.SATDVDMMDI..DSK.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.89| 15| 19| 67| 83| 3
---------------------------------------------------------------------------
67- 83 (24.61/18.56) TSNGQ.....LLSSPPssTPMS
84- 103 (22.29/10.33) TQNSQqptvsVTASFP..TPAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.01| 22| 38| 284| 305| 4
---------------------------------------------------------------------------
284- 305 (38.41/23.94) PEEE.WQIQKVHGKEIKVAEAES
323- 345 (36.60/22.53) PNSEyWEDILGHEKPSKHTAFES
---------------------------------------------------------------------------
|