<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16528
| Description |
Uncharacterized protein |
| Sequence | MPLRPHIGLGFPAHAYQKRHVEPHDRSTGYQPKVRITDRYRIIGFISSGTYGRVYKAVGRNGKPVGEFAIKKFKPDKEGEQISYTGISQSAIREMSLCSELHHINVIRLCEIMLEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPATIKSIMFQLLNGCQYLHINWVLHRDLKPANIMVTSSGEVKIGDLGLARRFDKPLHSLFSGDKVVVTIWYRAPELILGSYHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIIEIMALSTTPAPPAVHHH |
| Length | 293 |
| Position | Kinase |
| Organism | Fusarium oxysporum f. sp. radicis-cucumerinum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium oxysporum species complex.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.217 |
| Instability index | 39.76 |
| Isoelectric point | 9.27 |
| Molecular weight | 33476.65 |
| Publications | PubMed=27387256
PubMed=28831051
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16528
No repeats found
|