<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16523
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MASQELTLDEIQWRSPAISQQMQGVHENSVLHYFSNSPFFDPTSNNAVLVSQAMYNPNMLEVIQTRAAFEGRLKTMSGLEFVIAEQPAEMAPGTGTGVWVIRKQTRRKRHPEDDEITIHSTYFVVGDNIYMAPTVADILGNRTMSIISSLSKFITAAAALPDFSPALGHVHVPPSASNRIKMSESQFSQASKENTPLPDSLRDSKKPVLSAATNGSSYFDNKILEDTINITLNLRK |
Length | 236 |
Position | Head |
Organism | Diplocarpon rosae |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.301 |
Instability index | 63.50 |
Isoelectric point | 6.07 |
Molecular weight | 26085.21 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16523
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.59| 15| 35| 148| 162| 1
---------------------------------------------------------------------------
148- 162 (23.99/17.14) SSLSKFITAAAALPD
185- 199 (26.60/19.78) SQFSQASKENTPLPD
---------------------------------------------------------------------------
|