<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16513
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MRMEDIKMENNQTPPPPIPLDEPRYGGFTRFEIELEFVQSLASPLYLNHLASQKYLENPAFIAYLSYLQYWSHPPYTKFLNYPGPTLKNLELLQQERFRADILSPEVTARLFEEGVKKSLEGPRN |
Length | 125 |
Position | Middle |
Organism | Diplocarpon rosae |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.574 |
Instability index | 47.81 |
Isoelectric point | 5.40 |
Molecular weight | 14634.52 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16513
No repeats found
No repeats found
|