<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16508
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MASQELTLDEIQWRSPAISQQMQGVHENSVLHYFSNSPFFDPTSNNAVLVSQAMYNPNMLEVIQTRAAFEGRLKTMSGLEFVIAEQPAEMAPGTGTGVWVIRKQTRRKRHPEDDEITIHSTYFVVGDNIYMAPTVADILGNRTMSVISSLSKFITAAAALPDFSPALGHVYVPPSASNRIKMGESQFSQASKENTPLPDSLRDCKKPILSSATNGSNYLDNKILQDTINISLKYGDEYMDEIPITGQPGEFHLSSTGRKDKDKLMVPVPAKGPLHVSRKSAAPAPMLLKTSIPPDRKNSKAEKSPKTPGAPKPKRRKSKVPEATPATSLRS |
Length | 331 |
Position | Head |
Organism | Diplocarpon rosae |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.486 |
Instability index | 57.63 |
Isoelectric point | 9.30 |
Molecular weight | 36303.99 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16508
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.33| 28| 35| 148| 178| 1
---------------------------------------------------------------------------
148- 178 (42.55/26.92) SSLSKFITAAAALPDfspALGHVYVP..PSASN
185- 214 (43.78/20.56) SQFSQASKENTPLPD...SLRDCKKPilSSATN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.85| 15| 17| 289| 305| 2
---------------------------------------------------------------------------
271- 285 (24.03/11.37) KGPLHVSRKS..AAPAP
289- 305 (21.82/15.80) KTSIPPDRKNskAEKSP
---------------------------------------------------------------------------
|