<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16499
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MLFGGSIPDALKSVIVELFRPEGLLDAVQEEIEPAKLFFADFTMLEVDEDRASIERRRKLHTTMDGFRKGWLANPVTKADATEASARASQGLTTGSGRQGARWRRCARCAAVMEDIMPQRQALQWLVMQQRRCYCSGYWDTLAPGERVA |
| Length | 149 |
| Position | Tail |
| Organism | Diplocarpon rosae |
| Kingdom | Fungi |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.346 |
| Instability index | 53.84 |
| Isoelectric point | 7.66 |
| Molecular weight | 16782.06 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16499
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.95| 18| 24| 98| 120| 1
---------------------------------------------------------------------------
100- 118 (32.34/25.15) GARW.....RRCaRCAAVMEDIMP
122- 144 (32.62/10.01) ALQWlvmqqRRC.YCSGYWDTLAP
---------------------------------------------------------------------------
|