<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16496
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MATPSEQQDNSIHKPFTKAERIQQLNDIDKSITQLLQSAGLALQTLSATQSQTEEPISSRKKAFQEASNSYLTTLQKVDVVLRRNIWGLEEANIINPEKARRKVPQTGNGMPGRAALEADAATADVNSLGKLDIGWLNSRSGRVGRDMEAELWERARMFLEAQQEREPDRKDVDVDS |
| Length | 177 |
| Position | Head |
| Organism | Diplocarpon rosae |
| Kingdom | Fungi |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.756 |
| Instability index | 59.44 |
| Isoelectric point | 5.36 |
| Molecular weight | 19774.86 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16496
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 11| 14| 7| 17| 1
---------------------------------------------------------------------------
7- 17 (21.77/16.96) QQDNSIHKPFT
23- 33 (19.58/14.62) QQLNDIDKSIT
---------------------------------------------------------------------------
|