<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16472
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MFNETEGSSSDPKAANRARFEVELEFVQSLANPFYLHSLAQQNILEQPAFINFLEYLQYFRDKDYARFIHYPHALHHLELLQHAQFRAEMKKDEFLREYLHQKQFDHWRTWRDPTHTNKTNDTSPAVDGVEGPGTMSST |
Length | 139 |
Position | Middle |
Organism | Armillaria gallica (Bulbous honey fungus) (Armillaria bulbosa) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Physalacriaceae> Armillaria.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.810 |
Instability index | 46.87 |
Isoelectric point | 5.80 |
Molecular weight | 16459.06 |
Publications | PubMed=29085064
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16472
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.56| 14| 16| 73| 86| 1
---------------------------------------------------------------------------
37- 50 (22.37/13.22) HSLAQQ.NILEQPAF
73- 86 (24.35/14.95) HALHHL.ELLQHAQF
91- 105 (18.85/10.15) KKDEFLrEYLHQKQF
---------------------------------------------------------------------------
|