<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16457
| Description |
Uncharacterized protein |
| Sequence | MPDLQAGQPPPPLFFPPFPNEEKMRRGRLNAEAPLGLPGETHSIGAPTVSPKGPDANQMGPGANPYRQDLRAPQPQFFDLDLDLNPDL |
| Length | 88 |
| Position | Middle |
| Organism | Armillaria solidipes |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Physalacriaceae> Armillaria.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.770 |
| Instability index | 65.86 |
| Isoelectric point | 4.65 |
| Molecular weight | 9568.67 |
| Publications | PubMed=29085064
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16457
No repeats found
|