<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16448
| Description |
Uncharacterized protein |
| Sequence | MQMNPSSVGPPPGSVGMPGSVGGGSIHNPGSVMNPGSMNPGSHQQHLMNPGSVGQPQSVGGGPSSVNPGSVGHPGYPWNNPPSVGQQYHHHPQYPPQ |
| Length | 97 |
| Position | Tail |
| Organism | Caenorhabditis japonica |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.808 |
| Instability index | 50.33 |
| Isoelectric point | 7.06 |
| Molecular weight | 9773.62 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16448
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.25| 15| 15| 49| 63| 1
---------------------------------------------------------------------------
11- 24 (28.10/ 6.90) .......PPGSVGMPGSVGGG
29- 41 (28.03/ 6.87) P........GSVMNPGSMNPG
42- 62 (27.12/ 6.42) ShqqhlmNPGSVGQPQSVGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.46| 15| 15| 63| 77| 3
---------------------------------------------------------------------------
63- 77 (31.48/10.02) PSSVNPGSVGHPGYP
81- 95 (33.98/11.33) PPSVGQQYHHHPQYP
---------------------------------------------------------------------------
|