<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16447
| Description |
Uncharacterized protein |
| Sequence | MALLILSTPNMFDVAFRKWVVQKTMEFGSFDKVSELVTSPIQNFLEDRLDVMSDKLRELEENFEILHDYSMTPQRRPKILMQTCGHVAGAAFYYQPRHFREENVDWPPPGKMGPNLSPSSSPNVKLKITGLPNRGGVDQVQDVRDVGEMSSDSSNSSDSSDDERDSKKTASSSKS |
| Length | 175 |
| Position | Middle |
| Organism | Caenorhabditis japonica |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.659 |
| Instability index | 52.67 |
| Isoelectric point | 5.24 |
| Molecular weight | 19690.87 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | cytoplasm GO:0005737 IEA:UniProtKB-KW
|
| GO - Biological Function | oxidoreductase activity GO:0016491 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16447
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.94| 16| 17| 138| 153| 1
---------------------------------------------------------------------------
138- 153 (27.65/18.96) DQVQDVRDVGEMSSDS
158- 173 (26.29/17.69) DSSDDERDSKKTASSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.46| 11| 17| 103| 115| 2
---------------------------------------------------------------------------
103- 115 (19.90/17.19) NVDWPPPGKmgPN
123- 133 (19.55/ 9.70) NVKLKITGL..PN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.20| 13| 21| 31| 47| 3
---------------------------------------------------------------------------
31- 47 (17.71/24.09) DKVSELVtspiQNF..LED
54- 68 (19.49/12.86) DKLRELE....ENFeiLHD
---------------------------------------------------------------------------
|