<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16438
| Description |
Uncharacterized protein |
| Sequence | MIGEVNAESKTTGECCIWILVRLVVERFSSGDWNMSNRDEPIISSVAPTYPNPESVAAPNSVMAPGSAAPQQTPQSVMQPGSMMGPQSVSSHYGMHRQQMGGPPSMQMNPSSVGPPPGSVGMPGSVGGGSIHNPGSVMNPGSMNPGSHQQHLMNPGSVGQPQSVGGGPSSVNPGSVGHPGYPWNNPPSVGQQYHHHPQYPPQ |
| Length | 202 |
| Position | Tail |
| Organism | Caenorhabditis japonica |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.570 |
| Instability index | 63.20 |
| Isoelectric point | 6.27 |
| Molecular weight | 20946.13 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16438
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.62| 15| 15| 154| 168| 2
---------------------------------------------------------------------------
139- 159 (24.90/ 6.10) NPGSMNPGShqqhlmNPGSVG
160- 177 (29.72/ 8.70) QPQSVGGGP...ssvNPGSVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.90| 19| 20| 48| 67| 3
---------------------------------------------------------------------------
63- 83 (33.40/ 9.20) MAPGSaaP.QQ.TPQSVMQPGSM
84- 106 (24.50/ 7.91) MGPQSvsShYGmHRQQMGGPPSM
---------------------------------------------------------------------------
|