<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16429
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MRREELKAAKKKEKEREEEKRRQDDEKLMQLEKKLEEFQENARFIGDLATHFQPKYQDTLNGRIYSLIRGLQDLDRMKSNYSDRKVPLDILPYLDNGKNPLLYSKNCMVATLEKNKAVNGKIEMYKKFRAHLMKAFSEEMPEIVYQYRNYRDDLDLA |
Length | 157 |
Position | Middle |
Organism | Caenorhabditis japonica |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -1.083 |
Instability index | 42.55 |
Isoelectric point | 8.98 |
Molecular weight | 18873.45 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16429
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.86| 18| 19| 2| 19| 1
---------------------------------------------------------------------------
2- 19 (28.69/15.94) RR...EELKAAKKKEKEREEE
21- 41 (25.18/13.21) RRqddEKLMQLEKKLEEFQEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.67| 12| 19| 71| 82| 3
---------------------------------------------------------------------------
71- 82 (22.36/12.88) LQDLDRMKSN..YS
91- 104 (19.31/10.32) LPYLDNGKNPllYS
---------------------------------------------------------------------------
|