<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16423
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MLEPGTSNAGGTTPGGSLRTKISLKSGTVVPPFHTFKLQLPPCSEVQGNHDLLTSYGLGPVDGGGIIGQRRVKEDMSAFLPHVIGRIEIQPEGDQSTLRKLIDKPPIHKEITHLSSSAMMGFKLSAGPVEERFTKIFAKRKEPNLAFGDKFNIVRHRPPYDAYGYEEDETEKGFPKKHKKKKKDKKRKKDKEAGDVDKKKKKGDERML |
| Length | 208 |
| Position | Head |
| Organism | Caenorhabditis japonica |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.863 |
| Instability index | 47.28 |
| Isoelectric point | 9.69 |
| Molecular weight | 23176.43 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16423
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.98| 16| 16| 168| 183| 1
---------------------------------------------------------------------------
168- 183 (28.02/13.36) DET...EKGFPKKHKKKKK
184- 202 (20.97/ 8.43) DKKrkkDKEAGDVDKKKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.72| 10| 15| 139| 148| 5
---------------------------------------------------------------------------
139- 148 (17.88/ 8.10) KRKEPNLAFG
155- 164 (20.84/10.31) RHRPPYDAYG
---------------------------------------------------------------------------
|