<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16410
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MSRLQRQSPPEQKQQPSQPQVSTQIPAEALEPIRNRLSQVHQSLRKLADQINLHNRNPAKVKLPSYSNLQSQFQVLITQLQTIAARLDTNDEILKSTNVYPVPSFPTTQHEGLVTTLLRKKPLPEVDEWIDAAIAESESFKLPIHADDEFAEWCYAKVKELEDEFTFEGFHTEEELQLMETEEGQKNEEEKTAAETENKKTIDEISGGKKPMSPNTVLRFMTRGVL |
| Length | 226 |
| Position | Head |
| Organism | Candida auris (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.759 |
| Instability index | 62.43 |
| Isoelectric point | 5.11 |
| Molecular weight | 25821.74 |
| Publications | PubMed=27988485
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16410
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.25| 23| 23| 128| 150| 1
---------------------------------------------------------------------------
128- 150 (41.09/29.82) EWIDAAIAESE.SFKL.PIHADDEF
152- 176 (34.16/23.69) EWCYAKVKELEdEFTFeGFHTEEEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.26| 21| 23| 17| 37| 2
---------------------------------------------------------------------------
17- 37 (34.61/23.81) SQPQVSTQIPAEALEPIRNRL
43- 63 (33.64/22.96) SLRKLADQINLHNRNPAKVKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.98| 15| 18| 89| 103| 3
---------------------------------------------------------------------------
89- 103 (26.94/20.22) TNDEILKSTNVY..PVP
108- 124 (22.05/15.29) TQHEGLVTTLLRkkPLP
---------------------------------------------------------------------------
|