Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSRLQRQSPPEQKQQPSQPQVSTQIPAEALEPIRNRLSQVHQSLRKLADQINLHNRNPAKVKLPSYSNLQSQFQVLITQLQTIAARLDTNDEILKSTNVYPVPSFPTTQHEGLVTTLLRKKPLPEVDEWIDAAIAESESFKLPIHADDEFAEWCYAKVKELEDEFTFEGFHTEEELQLMETEEGQKNEEEKTAAETENKKTIDEISGGKKPMSPNTVLRFMTRGVL |
Length | 226 |
Position | Head |
Organism | Candida auris (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.759 |
Instability index | 62.43 |
Isoelectric point | 5.11 |
Molecular weight | 25821.74 |
Publications | PubMed=27988485 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16410 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.25| 23| 23| 128| 150| 1 --------------------------------------------------------------------------- 128- 150 (41.09/29.82) EWIDAAIAESE.SFKL.PIHADDEF 152- 176 (34.16/23.69) EWCYAKVKELEdEFTFeGFHTEEEL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.26| 21| 23| 17| 37| 2 --------------------------------------------------------------------------- 17- 37 (34.61/23.81) SQPQVSTQIPAEALEPIRNRL 43- 63 (33.64/22.96) SLRKLADQINLHNRNPAKVKL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.98| 15| 18| 89| 103| 3 --------------------------------------------------------------------------- 89- 103 (26.94/20.22) TNDEILKSTNVY..PVP 108- 124 (22.05/15.29) TQHEGLVTTLLRkkPLP --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) MSRLQRQSPPEQKQQPSQPQVSTQIPAEALEPI 2) TEEELQLMETEEGQKNEEEKTAAETENKKTIDEISGG | 1 172 | 33 208 |
MoRF Sequence | Start | Stop |
1) KKTIDEI 2) RFMTRGVL | 199 219 | 205 226 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab