<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16393
| Description |
RNA polymerase II transcriptional regulation mediator |
| Sequence | MATTPMIPPAAGPNSALDGGAPPAMPPPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDYSCNNEQLRVRAIHPLDISHLSKMTGTEYMLSEVLEPHLFVFKKQKRDGPEKVTPMLTYYILDGSIYQAPQLCNVFASRVGRALYHISKAFNTAASKLEKIGYVDDENESTSSEPKTAKETIDLKELKRVDHYLATLQRKLPPAPPPPPFPEGYTPPTAEGEKRSDTPQTEPLPAVDPIIDQGPSKRMKLT |
| Length | 256 |
| Position | Head |
| Organism | Handroanthus impetiginosus |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance>
Handroanthus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.498 |
| Instability index | 57.06 |
| Isoelectric point | 5.77 |
| Molecular weight | 28492.23 |
| Publications | PubMed=29253216
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16393
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.06| 15| 15| 129| 143| 1
---------------------------------------------------------------------------
129- 143 (27.78/17.20) G.SIYQAPQLCNVFAS
146- 161 (21.28/11.88) GrALYHISKAFNTAAS
---------------------------------------------------------------------------
|