<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16391
Description |
Uncharacterized protein |
Sequence | MQLEGTETGDANGEDWQEEIYQKDQQQQSQNSQQYLYNQQLRQHLMQHKFQPGGVPQSIMQSQIQQQQQQNLLQPNQLQSSQHAVMQNSLWQTPASSTLQNQQSSLQQSAQSMLQQQPKSVHMLQQSKVPVQQQTQPNMANMLPNQGQQLQSEPLQQQLMSQIQSQPGQLQQQMGLQEQANALQRDMPQRIQTPGPLLQQQTTIDQPKQLLQSQRGIPEAPMNSSTQTGNANGGGWQEEIYQKIKSMNEMYFPELNEMYQRMAAKLQQHDALPQQAKNEQLQKLRFFKVMLERLIVFLQTNKNEIQPIHKEKIVGAEKQICQYS |
Length | 324 |
Position | Tail |
Organism | Handroanthus impetiginosus |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance>
Handroanthus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.059 |
Instability index | 87.02 |
Isoelectric point | 6.31 |
Molecular weight | 37396.54 |
Publications | PubMed=29253216
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16391
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 195.71| 38| 38| 24| 61| 1
---------------------------------------------------------------------------
18- 56 (67.03/19.16) EEI.YQ.......kD.QQQQSQNSQQYLYNQ....QLRQ.H.LMQHKFQPGGVP
57- 94 (43.08/ 9.12) QSI.MQ.......sQiQQQQQQNLLQ..PNQ...lQSSQ.HaVMQNSLWQT..P
96- 130 (48.36/11.33) SST.LQ........N.QQSSLQQSAQSMLQQ....QPKSvH.MLQQ....SKVP
172- 218 (37.24/ 6.66) QQMgLQeqanalqrD.MPQRIQTPGPLLQQQttidQPKQ.L.LQSQR....GIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.92| 12| 218| 6| 17| 3
---------------------------------------------------------------------------
6- 17 (25.60/17.36) TETGDANGEDWQ
226- 237 (26.31/18.03) TQTGNANGGGWQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.00| 15| 31| 258| 281| 5
---------------------------------------------------------------------------
258- 279 (21.16/27.01) MYQRMAAKLQQHdalpqqaKNE
290- 304 (25.84/ 8.83) MLERLIVFLQTN.......KNE
---------------------------------------------------------------------------
|