<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16386
| Description |
Uncharacterized protein |
| Sequence | MDGGDWRSQLHPDSRQGIVNKMGEMQLEGTETGDANGEDWQEEIYQKIKSMNEMYFPELNEMYQRMAAKLQQHDALPQQARNEHVFKVMLEHLIIFLQTNKNDIQPTHKDKIPGVEMQIINILNAIAPRRSVSSLQQG |
| Length | 138 |
| Position | Tail |
| Organism | Handroanthus impetiginosus |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance>
Handroanthus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.783 |
| Instability index | 58.88 |
| Isoelectric point | 5.31 |
| Molecular weight | 15961.90 |
| Publications | PubMed=29253216
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16386
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.20| 10| 32| 2| 11| 2
---------------------------------------------------------------------------
2- 11 (20.32/11.36) DGGDWRSQLH
36- 45 (19.89/11.01) NGEDWQEEIY
---------------------------------------------------------------------------
|