| Description | Uncharacterized protein |
| Sequence | MDGGDWRSQLHPDSRQGIVNKMGEMQLEGTETGDANGEDWQEEIYQKIKSMNEMYFPELNEMYQRMAAKLQQHDALPQQARNEHVFKVMLEHLIIFLQTNKNDIQPTHKDKIPGVEMQIINILNAIAPRRSVSSLQQG |
| Length | 138 |
| Position | Tail |
| Organism | Handroanthus impetiginosus |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance> Handroanthus. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.783 |
| Instability index | 58.88 |
| Isoelectric point | 5.31 |
| Molecular weight | 15961.90 |
| Publications | PubMed=29253216 |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro transcription coactivator activity GO:0003713 IEA:InterPro |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP16386
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.20| 10| 32| 2| 11| 2
---------------------------------------------------------------------------
2- 11 (20.32/11.36) DGGDWRSQLH
36- 45 (19.89/11.01) NGEDWQEEIY
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DWRSQLH 2) EDWQEEIYQKIKSMNEMYF | 5 38 | 11 56 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab