<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16377

Description Uncharacterized protein
SequenceMAAMEGVVTAGAQDQKQPPTARVVESLNPAVQQQLNLDSVKTRAISLSKAISRILEDFDVIARTSAVPKWQDILGQFSMVNLELYNIVEDIKNVSKAFVVHPKNVNAENATILPVMLSSKLLPEMEMDDNAKREQLLHSMQSLPVGAQIEKLKTRIDMIGAACESAEKIIADARKTYFGTRQGPTLLPTIDKVQAAKIQEQENLLRSAVNHGEGLRVPGEQRQVTSSLPMHLVDVLNVNDSAQTFSDSSGMYQKSTPPMSTTSNNSQGSLIQASGAQLIGRAAASPSGPTGSTSFDNTTASPMQYANSPRSGANIMNTPSPQQQQQQQQLQQHQHQQRQKIMQLPPHQQQLLSQQPLRPSSMTSLGQNQLSQLHDMQSQTQQKFQSMHGQHHVQFSQPLAAPQLQGRQLTSAAMHMGQNQLSQGNQLSRQLNQFSSPANSALFNAAQTAPTSQMIPNMSAMMPSQSILPRMQFGLSGSNRTLPPQNLADQMFSMGAANTGGMMPIQQQQQHGTQGAFGNMPQSAQNLQPGMVPMQNTPQNHHNFQQQRPQNQQ
Length553
PositionHead
OrganismHandroanthus impetiginosus
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance> Handroanthus.
Aromaticity0.03
Grand average of hydropathy-0.595
Instability index59.90
Isoelectric point9.25
Molecular weight60488.57
Publications
PubMed=29253216

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16377
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      88.96|      18|      18|     462|     479|       1
---------------------------------------------------------------------------
  462-  479 (32.99/11.59)	MPSQSILPRMQFGLSGSN
  482-  498 (28.72/ 9.12)	LPPQNLADQM.FSMGAAN
  503-  517 (27.25/ 8.27)	MPIQQ...QQQHGTQGAF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.84|      21|      24|     367|     388|       3
---------------------------------------------------------------------------
  348-  368 (30.47/10.57)	Q.QQLLSQQPLRPSSMTSLGQN
  369-  390 (33.37/15.87)	QlSQLHDMQSQTQQKFQSMHGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.27|      10|      18|     519|     528|       4
---------------------------------------------------------------------------
  519-  528 (19.04/ 7.62)	NMPQSAQNLQ
  536-  545 (21.23/ 9.35)	NTPQNHHNFQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.36|      19|      19|      26|      44|       5
---------------------------------------------------------------------------
   26-   44 (31.66/21.87)	SLNPAVQQQL.NLDSV.KTRA
   46-   66 (21.70/12.70)	SLSKAISRILeDFDVIaRTSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      68.29|      20|      23|     394|     413|       6
---------------------------------------------------------------------------
  405-  421 (21.23/ 7.51)	QGRQLTSAA.....mHMGQNQL
  423-  443 (26.66/11.49)	QGNQLSRQLnQFSS.PANSALF
  444-  460 (20.40/ 6.90)	NAAQTAPTS.QMIP.NMSA...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     115.18|      25|      28|     226|     250|       7
---------------------------------------------------------------------------
  226-  250 (41.06/24.50)	SSLPMHLVDVLNVNDSAQTFSDS..SG
  255-  275 (35.48/20.08)	STPPMSTTS....NNSQGSLIQA..SG
  286-  312 (38.63/22.57)	PSGPTGSTSFDNTTASPMQYANSprSG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16377 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QENLLRSAVNHGEGLRVPGEQRQVTSSLPMHLV
2) QTFSDSSGMYQKSTPPMSTTSNNSQGSLIQASGAQLIGRAAASPSGPTGSTSFDNTTASPMQYANSPRSGANIMNTPSPQQQQQQQQLQQHQHQQRQKIMQLPPHQQQLLSQQPLRPSSMTSLGQNQLSQLHDMQSQTQQKFQSMHGQHHVQFSQPLAAPQLQGRQLTSAAMHMGQNQLSQGNQLSRQLNQFSSPANSALFNAAQTAPTSQMIPNMSAMMPSQSILPRMQFGLSGSNRTLPPQNLADQMFSMGAANTGGMMPIQQQQQHGTQGAFGNMPQSAQNLQPGMVPMQNTPQNHHNFQQQRPQNQQ
201
243
233
553










Molecular Recognition Features






MoRF SequenceStartStop




NANANA