<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16369
| Description |
"RNA polymerase II holoenzyme and mediator subcomplex, subunit SURB7/SRB7" |
| Sequence | MDIISQLQEQVNTIASLAFNTFGTLQRDAPPVQLSPNYPEPPANASAVEDAANISEQPKLLSAELVKAAKQFDALVAALPLSEGGEEAQLKRIAELQVQGHLSSMLIGSYTRLIMKFWLDYLHSLHCWGNRCANPSASWFIHHVADCLFFSFSSSSMQEYKALTVPRYTNMLPLP |
| Length | 175 |
| Position | Middle |
| Organism | Handroanthus impetiginosus |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance>
Handroanthus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.030 |
| Instability index | 50.56 |
| Isoelectric point | 5.45 |
| Molecular weight | 19365.91 |
| Publications | PubMed=29253216
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16369
No repeats found
No repeats found
|