<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16351
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDSSQASAAATAGGGGNSFMMSQSADGSPVDSSAATAATSIDDPKQNLTQVMNSIQKTLGILHQLYLTVSAYNVASQLPLLQRMNNLVQELDNMARLAEKTKIQVPMEVLNLIDDGKNPDEFTREMLNGCIAKNQITKGKTDTFKSLRRHLLEELDETFPDDIEGYREIRAASAAETRRLAQSQNMLPNGDVKVKTEM |
Length | 198 |
Position | Middle |
Organism | Handroanthus impetiginosus |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance>
Handroanthus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.459 |
Instability index | 41.78 |
Isoelectric point | 4.99 |
Molecular weight | 21622.15 |
Publications | PubMed=29253216
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16351
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.05| 25| 30| 50| 79| 2
---------------------------------------------------------------------------
50- 79 (36.13/30.28) QVMNSIQKTLGILHQLyltvsAYNVASQLP
82- 106 (41.92/23.92) QRMNNLVQELDNMARL.....AEKTKIQVP
---------------------------------------------------------------------------
|