<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16345
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MEHFGGGGNWAMIPNIQSHSNPATPSNQDHLFLQQQQFNQQQQFQQQFSQQQQQQQPRFQQQQPQQQQPPQALRRVKVEELVENLAEVTENGTRDQQTDALIGELNTQFEKCQQLLNSIGGTIKAKSTTVEGQKHKVEETDNLLVQRRDLISKYRNSVEELINSEI |
| Length | 166 |
| Position | Middle |
| Organism | Handroanthus impetiginosus |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance>
Handroanthus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.090 |
| Instability index | 63.22 |
| Isoelectric point | 5.36 |
| Molecular weight | 19149.85 |
| Publications | PubMed=29253216
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16345
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.73| 17| 18| 34| 50| 1
---------------------------------------------------------------------------
34- 50 (34.97/11.24) QQQQ..FNQQQQFQQQFSQ
53- 71 (31.75/ 9.61) QQQQprFQQQQPQQQQPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.08| 12| 74| 74| 85| 3
---------------------------------------------------------------------------
74- 85 (17.92/12.00) RRVKVEELVENL
94- 105 (19.16/13.24) RDQQTDALIGEL
---------------------------------------------------------------------------
|