<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16345

Description Mediator of RNA polymerase II transcription subunit 9
SequenceMEHFGGGGNWAMIPNIQSHSNPATPSNQDHLFLQQQQFNQQQQFQQQFSQQQQQQQPRFQQQQPQQQQPPQALRRVKVEELVENLAEVTENGTRDQQTDALIGELNTQFEKCQQLLNSIGGTIKAKSTTVEGQKHKVEETDNLLVQRRDLISKYRNSVEELINSEI
Length166
PositionMiddle
OrganismHandroanthus impetiginosus
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance> Handroanthus.
Aromaticity0.05
Grand average of hydropathy-1.090
Instability index63.22
Isoelectric point5.36
Molecular weight19149.85
Publications
PubMed=29253216

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats
>MDP16345
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.73|      17|      18|      34|      50|       1
---------------------------------------------------------------------------
   34-   50 (34.97/11.24)	QQQQ..FNQQQQFQQQFSQ
   53-   71 (31.75/ 9.61)	QQQQprFQQQQPQQQQPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.08|      12|      74|      74|      85|       3
---------------------------------------------------------------------------
   74-   85 (17.92/12.00)	RRVKVEELVENL
   94-  105 (19.16/13.24)	RDQQTDALIGEL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16345 with Med9 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MEHFGGGGNWAMIPNIQSHSNPATPSNQDHLFLQQQ
2) QFQQQFSQQQQQQQPRFQQQQPQQQQPPQALRRV
1
43
36
76










Molecular Recognition Features






MoRF SequenceStartStop




NANANA