<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16341
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQNIPHQIVQSPARLGLPNPNSPSLQNSNQPKFSSQSQQTQQSHLPVNQLTTPAISSTLLPLLPPLPRAQSLLLQMASLVSKLFEVSPNRSHWISAFRGSLPSFLPSQNQPLAPNLPDSSQSSAKEILAQFSTLQNQLFEAVAELQEILDLQDAKQKLSRDIRSKDSALLAFANKLKEAEHVLDNLVDDYSDYRRPKRSKSVDDPEGSSTTTVATQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQEEQMRASQIYNFADLDVGLPKTDEQKEKIIEPLIEPPAALPSESNPLSNMPGMQGLLPPNFVVPSGWKPGMPVELPSDLPILPPPGWKPGDPITLPPLDSLPIPPRADEQQLRPIPPPGLAKAPEPIQVRHVQLDIEDDSSDYSSDVGSSDSED |
| Length | 410 |
| Position | Middle |
| Organism | Handroanthus impetiginosus |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance>
Handroanthus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.475 |
| Instability index | 76.29 |
| Isoelectric point | 4.87 |
| Molecular weight | 44733.96 |
| Publications | PubMed=29253216
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16341
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 111.82| 30| 32| 320| 349| 1
---------------------------------------------------------------------------
237- 260 (30.52/ 6.71) ....PPEFGAGQ.A...PLrGALP..PAPQEEQM
261- 314 (30.18/ 6.57) PLIEPPAALPSESN...PL.SNMPGMQGLLP...
336- 368 (51.12/15.72) PILPPPGWKPGDPItlpPL.DSLPIPPRADEQQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.92| 21| 32| 67| 97| 2
---------------------------------------------------------------------------
67- 90 (29.12/13.38) LPraqSLL.LQMASLVSKLFEVSPN
102- 123 (31.80/18.18) LP...SFLpSQNQPLAPNLPDSSQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 128.30| 40| 40| 139| 178| 4
---------------------------------------------------------------------------
125- 168 (53.03/36.37) AkeILAQFSTLQnqLFEAVAEL..Q..EI.LD.LQDAKQKLSRDIRSK......DS
169- 209 (39.77/25.30) A..LLAFANKLK..........eaE..HV.LDnLVDDYSDYRRPKRSKsvddpeGS
376- 408 (35.49/21.72) ..............LAKAPEPI..QvrHVqLD.IEDDSSDYSSDVGSS......DS
---------------------------------------------------------------------------
|