<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16337
| Description |
Uncharacterized protein |
| Sequence | MSAEAQSGRNPSRVQVKCRVDPKPTAENKNDFYFRVGRTFQFKTPKPRVSSSKKLRKRERKMQQAAARPPTQESAATGDAPPKQVAQALEQLGQAGRLIADVRLGADRLLEALFTVGDAPHHQHSSKCLNLIIKEESLMRHHLQNLRAIGRQLEESGVLNDSLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTR |
| Length | 205 |
| Position | Tail |
| Organism | Handroanthus impetiginosus |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Lamiales> Bignoniaceae> Crescentiina> Tabebuia alliance>
Handroanthus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.670 |
| Instability index | 48.99 |
| Isoelectric point | 10.38 |
| Molecular weight | 22708.63 |
| Publications | PubMed=29253216
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16337
No repeats found
|