<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16323
Description |
Uncharacterized protein |
Sequence | MATNFWSSSHYKRWIVDRSTLHQARSDDLQYVDNPEYLGFLNIFFANLISKLGKKLQLRQRVIATATVFFRRFYVKNSYCETDPFIVIAACCYVAAKAEESPVHIKNVVSEARMLFGEEYGIKSFPSDNSKLAEMEFYLVDELECDLTIFHPYRTLMTLCGKEGGGAVPEAEAGEADADDVDGLRYWGTGEGKLELQEGALQMAWFIINDTYRSELCLLYPPHLIAIAAIYLTLVFHAQTRTSIQQSASSSHSHSGSSHPSHSGSPTRRSSRSTSHSQKKQHHQQDVIGFMAGLNVSMSLVATIAQEIISLLG |
Length | 313 |
Position | Kinase |
Organism | Ganoderma sinense ZZ0214-1 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Ganoderma.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.176 |
Instability index | 54.40 |
Isoelectric point | 6.11 |
Molecular weight | 35017.25 |
Publications | PubMed=26046933
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16323
No repeats found
|