<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16313
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MFYDKQSNNQVLRMQTMHTGAPLVNEAEELKRFTGIEFALVHSEAPSLFIIHKRERLSPDEVRPLAVYFILNNRIYQSPDVYSLTSNRLLASLHSLQKSLDILRTHRPAYTPRTGFVWPIVEPSSGDTAAKKRSQDVETATEPGTQEAETLSDARGIPAASSDAKRRQNNMLLFNAMRTTAVHAHQSFQLPAVPSEETVPETPATATAGRSSVTPAPAPGGGTTTRAPSIAPVPQEPAKGPPGGGKKKKKRTATLPPPAP |
| Length | 260 |
| Position | Head |
| Organism | Ganoderma sinense ZZ0214-1 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Ganoderma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.539 |
| Instability index | 71.81 |
| Isoelectric point | 9.69 |
| Molecular weight | 28217.61 |
| Publications | PubMed=26046933
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16313
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.33| 18| 21| 219| 238| 1
---------------------------------------------------------------------------
219- 238 (27.43/18.74) PGGGTTTRAPSiAPVPqEPA
242- 259 (31.90/14.13) PGGGKKKKKRT.ATLP.PPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.94| 16| 19| 49| 65| 2
---------------------------------------------------------------------------
49- 65 (25.75/19.98) FIIHKRERLSPDeVRPL
69- 84 (30.19/18.68) FILNNRIYQSPD.VYSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.52| 31| 118| 13| 45| 3
---------------------------------------------------------------------------
13- 45 (50.88/29.26) RMQTMHTGA.PLVNEAEELKRFTGIEFAlvHSEA
133- 164 (48.64/23.34) RSQDVETATePGTQEAETLSDARGIPAA..SSDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.62| 12| 22| 180| 192| 4
---------------------------------------------------------------------------
180- 192 (18.66/13.15) TAvHAHQSFQLPA
205- 216 (20.96/10.41) TA.TAGRSSVTPA
---------------------------------------------------------------------------
|