| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSFSTFAGPSSHPSLPGSQSTYPSQSSQSGFSQSYAPFVTPDIPPQPPASMSEILLDPLARLQTLSHTVFQSLGPPQSRPPPPPSVVELLAVDAQLATAVHIARAHQVKQRRIEQLKDEVLDLDRRWREIVRALDEGRRELDSIVREGEERIKAIDEAKAASIPYPELLAYAQSLSAFTSAPPNMPDLAPGQPPPPLFFPPFPNEEKMRRGHMNDEAPLGILGETHSVKPPPPVSPTVEHPAHPGANPYRPDFRPPQQQPFFDLDLDLNPDL |
| Length | 272 |
| Position | Middle |
| Organism | Ganoderma sinense ZZ0214-1 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Polyporaceae> Ganoderma. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.537 |
| Instability index | 83.57 |
| Isoelectric point | 5.25 |
| Molecular weight | 29917.37 |
| Publications | PubMed=26046933 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP16311
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 170.28| 33| 33| 16| 48| 1
---------------------------------------------------------------------------
16- 48 (61.06/24.03) PGSQSTY...P....SQS....SQSGFSQSYAPF....VTPDIPPQ..PP
50- 83 (36.88/11.67) ..SMSEIlldP....LARlqtlSHTVF.QSLGP.......PQSRPP..PP
200- 233 (30.94/ 8.64) ....PPF...PneekMRR....GHM...NDEAPLgilgETHSVKPP..PP
234- 260 (41.41/13.99) VSPTVEH...P....AHP....GANPYR............PDFRPPqqQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.35| 23| 26| 102| 126| 3
---------------------------------------------------------------------------
88- 116 (30.07/30.51) ELLAVDAQlatavhIARAHQVKQRRIEQL
119- 144 (31.28/22.34) EVLDLDRR...wreIVRALDEGRRELDSI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) PFFDLDLDLNPD 2) YRPDFRP | 260 249 | 271 255 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab