<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16307
Description |
Putative mediator of RNA polymerase II transcription subunit 27 |
Sequence | MGNLGQISLDPVLDKTPIYPQVLQTYKWSTKLREHAQAADSILNRQAPKRTYGHISVLSKKRKTPPSSHTYNPVHVDKFFDTWQKNYTSVEVKRVQQSPNVFQVTLGRTLQVVLVLQSFIIERVIVRAHHEVILQVDGTLDLWTQSKYAVFRKITDHATSAMLNFHFMTMPELSVKSFMLWLNSYLRLFTMPCKKCGRILKGNMPPTWRDFVTLSALHESCRQ |
Length | 223 |
Position | Tail |
Organism | Stichopus japonicus (Sea cucumber) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.267 |
Instability index | 45.72 |
Isoelectric point | 9.90 |
Molecular weight | 25844.79 |
Publications | PubMed=29023486
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16307
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.56| 19| 46| 5| 26| 1
---------------------------------------------------------------------------
5- 26 (29.99/31.41) GQISldpVLDKTPIYPQVLQTY
53- 71 (35.56/26.00) GHIS...VLSKKRKTPPSSHTY
---------------------------------------------------------------------------
|