<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16303
| Description |
Cell division protein kinase 8 (Fragment) |
| Sequence | NQHNILVMGEGPDRGRVKIADMGFARLFNSPLTPLANLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTNTPYHRDQLDRIFMVMGFPQDKDWEDIKKMPEHGTLLKDFKKANYAHYSLIRYMDKHKVKADSKAFQLLSKLLIVDPMKRITSELAMEDPFFKEEPLPTLDVFDGKTIQYPKREFLTDEDNEEKSVSKQKTSSSGHSSNAKRIRSSGQSGGMMQQDYQSSQQKHMMSGYQGGSGQGNHNQGQGNRMYTSGSGSHTGHSKMTHGSQHHQSHSQHHQRQHQQHPHRY |
| Length | 316 |
| Position | Kinase |
| Organism | Stichopus japonicus (Sea cucumber) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Echinodermata> Eleutherozoa> Echinozoa> Holothuroidea>
Aspidochirotacea> Aspidochirotida> Stichopodidae> Apostichopus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.868 |
| Instability index | 46.63 |
| Isoelectric point | 8.98 |
| Molecular weight | 36218.40 |
| Publications | PubMed=29023486
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | cell division GO:0051301 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP16303
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.08| 16| 18| 237| 252| 1
---------------------------------------------------------------------------
237- 252 (30.61/16.24) SGQSGGMMQQDYQSSQ
258- 273 (31.47/16.88) SGYQGGSGQGNHNQGQ
---------------------------------------------------------------------------
|